Placeholder image of a protein
Icon representing a puzzle

2001: Revisiting Puzzle 66: Cytochrome

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
June 03, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 10,026
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,995
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,710
  4. Avatar for Australia 14. Australia 1 pt. 9,669
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,810
  1. Avatar for johnmitch 11. johnmitch Lv 1 70 pts. 10,218
  2. Avatar for robgee 12. robgee Lv 1 67 pts. 10,209
  3. Avatar for Skippysk8s 13. Skippysk8s Lv 1 65 pts. 10,202
  4. Avatar for fiendish_ghoul 14. fiendish_ghoul Lv 1 62 pts. 10,194
  5. Avatar for toshiue 15. toshiue Lv 1 60 pts. 10,192
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 57 pts. 10,187
  7. Avatar for MicElephant 17. MicElephant Lv 1 55 pts. 10,186
  8. Avatar for maithra 18. maithra Lv 1 53 pts. 10,183
  9. Avatar for guineapig 19. guineapig Lv 1 51 pts. 10,179
  10. Avatar for frood66 20. frood66 Lv 1 49 pts. 10,176

Comments