Placeholder image of a protein
Icon representing a puzzle

2001: Revisiting Puzzle 66: Cytochrome

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
June 03, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 10,026
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,995
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,710
  4. Avatar for Australia 14. Australia 1 pt. 9,669
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,810
  1. Avatar for Maerlyn138 41. Maerlyn138 Lv 1 19 pts. 10,069
  2. Avatar for fishercat 42. fishercat Lv 1 18 pts. 10,062
  3. Avatar for kyoota 43. kyoota Lv 1 18 pts. 10,052
  4. Avatar for NeedMoreCoffee 44. NeedMoreCoffee Lv 1 17 pts. 10,050
  5. Avatar for akaaka 45. akaaka Lv 1 16 pts. 10,047
  6. Avatar for rezaefar 46. rezaefar Lv 1 15 pts. 10,042
  7. Avatar for equilibria 47. equilibria Lv 1 14 pts. 10,033
  8. Avatar for ProfVince 48. ProfVince Lv 1 14 pts. 10,027
  9. Avatar for manu8170 49. manu8170 Lv 1 13 pts. 10,026
  10. Avatar for zo3xiaJonWeinberg 50. zo3xiaJonWeinberg Lv 1 12 pts. 10,026

Comments