Placeholder image of a protein
Icon representing a puzzle

2001: Revisiting Puzzle 66: Cytochrome

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
June 03, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 10,026
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,995
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,710
  4. Avatar for Australia 14. Australia 1 pt. 9,669
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,810

  1. Avatar for Vinara 71. Vinara Lv 1 4 pts. 9,885
  2. Avatar for zippyc137 72. zippyc137 Lv 1 4 pts. 9,883
  3. Avatar for Matroch 73. Matroch Lv 1 3 pts. 9,877
  4. Avatar for NPrincipi 74. NPrincipi Lv 1 3 pts. 9,845
  5. Avatar for Trajan464 75. Trajan464 Lv 1 3 pts. 9,829
  6. Avatar for heather-1 76. heather-1 Lv 1 3 pts. 9,826
  7. Avatar for Crossed Sticks 77. Crossed Sticks Lv 1 3 pts. 9,825
  8. Avatar for rabamino12358 78. rabamino12358 Lv 1 2 pts. 9,823
  9. Avatar for Arne Heessels 79. Arne Heessels Lv 1 2 pts. 9,814
  10. Avatar for martinzblavy 80. martinzblavy Lv 1 2 pts. 9,795

Comments