Placeholder image of a protein
Icon representing a puzzle

2001: Revisiting Puzzle 66: Cytochrome

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
June 03, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 10,026
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,995
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,710
  4. Avatar for Australia 14. Australia 1 pt. 9,669
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,810
  1. Avatar for Mohoernchen 81. Mohoernchen Lv 1 2 pts. 9,779
  2. Avatar for kevin everington 82. kevin everington Lv 1 2 pts. 9,770
  3. Avatar for jsfoldingaccount 83. jsfoldingaccount Lv 1 2 pts. 9,760
  4. Avatar for Dr.Sillem 84. Dr.Sillem Lv 1 2 pts. 9,755
  5. Avatar for ManVsYard 85. ManVsYard Lv 1 2 pts. 9,739
  6. Avatar for mleon059 86. mleon059 Lv 1 1 pt. 9,718
  7. Avatar for dahast.de 87. dahast.de Lv 1 1 pt. 9,710
  8. Avatar for rinze 88. rinze Lv 1 1 pt. 9,686
  9. Avatar for drumpeter18yrs9yrs 89. drumpeter18yrs9yrs Lv 1 1 pt. 9,671
  10. Avatar for AlkiP0Ps 90. AlkiP0Ps Lv 1 1 pt. 9,669

Comments