Placeholder image of a protein
Icon representing a puzzle

2001: Revisiting Puzzle 66: Cytochrome

Closed since almost 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 03, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,247
  2. Avatar for Go Science 2. Go Science 70 pts. 10,246
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 10,237
  4. Avatar for Gargleblasters 4. Gargleblasters 30 pts. 10,224
  5. Avatar for Contenders 5. Contenders 19 pts. 10,187
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,176
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,175
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 10,139
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 10,108
  10. Avatar for METU-BIN 10. METU-BIN 1 pt. 10,082

  1. Avatar for nicobul 21. nicobul Lv 1 47 pts. 10,175
  2. Avatar for silent gene 22. silent gene Lv 1 45 pts. 10,174
  3. Avatar for christioanchauvin 23. christioanchauvin Lv 1 43 pts. 10,173
  4. Avatar for georg137 24. georg137 Lv 1 42 pts. 10,166
  5. Avatar for Anfinsen_slept_here 25. Anfinsen_slept_here Lv 1 40 pts. 10,154
  6. Avatar for NeLikomSheet 26. NeLikomSheet Lv 1 38 pts. 10,151
  7. Avatar for borattt 27. borattt Lv 1 37 pts. 10,142
  8. Avatar for Lotus23 28. Lotus23 Lv 1 35 pts. 10,142
  9. Avatar for jamiexq 29. jamiexq Lv 1 34 pts. 10,139
  10. Avatar for Simek 30. Simek Lv 1 32 pts. 10,139

Comments