Placeholder image of a protein
Icon representing a puzzle

2001: Revisiting Puzzle 66: Cytochrome

Closed since almost 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 03, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,247
  2. Avatar for Go Science 2. Go Science 70 pts. 10,246
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 10,237
  4. Avatar for Gargleblasters 4. Gargleblasters 30 pts. 10,224
  5. Avatar for Contenders 5. Contenders 19 pts. 10,187
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,176
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,175
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 10,139
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 10,108
  10. Avatar for METU-BIN 10. METU-BIN 1 pt. 10,082

  1. Avatar for yannma 31. yannma Lv 1 31 pts. 10,136
  2. Avatar for jobo0502 32. jobo0502 Lv 1 29 pts. 10,131
  3. Avatar for NinjaGreg 33. NinjaGreg Lv 1 28 pts. 10,128
  4. Avatar for WBarme1234 34. WBarme1234 Lv 1 27 pts. 10,128
  5. Avatar for Keresto 35. Keresto Lv 1 26 pts. 10,123
  6. Avatar for Norrjane 36. Norrjane Lv 1 25 pts. 10,121
  7. Avatar for dcrwheeler 37. dcrwheeler Lv 1 23 pts. 10,111
  8. Avatar for vuvuvu 38. vuvuvu Lv 1 22 pts. 10,108
  9. Avatar for OWM3 39. OWM3 Lv 1 21 pts. 10,094
  10. Avatar for yabuzhan 40. yabuzhan Lv 1 20 pts. 10,082

Comments