Placeholder image of a protein
Icon representing a puzzle

2001: Revisiting Puzzle 66: Cytochrome

Closed since almost 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 03, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,247
  2. Avatar for Go Science 2. Go Science 70 pts. 10,246
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 10,237
  4. Avatar for Gargleblasters 4. Gargleblasters 30 pts. 10,224
  5. Avatar for Contenders 5. Contenders 19 pts. 10,187
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,176
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,175
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 10,139
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 10,108
  10. Avatar for METU-BIN 10. METU-BIN 1 pt. 10,082

  1. Avatar for Wiz kid 51. Wiz kid Lv 1 12 pts. 10,020
  2. Avatar for stomjoh 52. stomjoh Lv 1 11 pts. 10,014
  3. Avatar for BarrySampson 53. BarrySampson Lv 1 11 pts. 10,013
  4. Avatar for Karlheinz 54. Karlheinz Lv 1 10 pts. 10,010
  5. Avatar for ucad 55. ucad Lv 1 9 pts. 10,007
  6. Avatar for tracybutt 56. tracybutt Lv 1 9 pts. 10,003
  7. Avatar for Oransche 57. Oransche Lv 1 8 pts. 9,999
  8. Avatar for ShadowTactics 58. ShadowTactics Lv 1 8 pts. 9,995
  9. Avatar for abiogenesis 59. abiogenesis Lv 1 8 pts. 9,990
  10. Avatar for phi16 60. phi16 Lv 1 7 pts. 9,988

Comments