Placeholder image of a protein
Icon representing a puzzle

2007: Large Electron Density Transcription factor

Closed since almost 5 years ago

Advanced Advanced Advanced Advanced Advanced Advanced Advanced Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
June 17, 2021
Expires
Max points
100
Description

Fold this Transcription factor (TF) into the electron density map! This puzzle might be tough, as this is a large protein. This electron density map comes from x-ray crystallography experiments, and outlines the shape of the folded protein, so help us determine the structure of this TF by folding it in the electron density! Sequence and additional information in the puzzle comments.

Top groups


  1. Avatar for Go Science 100 pts. 28,934
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 26,712
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 25,638
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 25,589
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 25,337
  6. Avatar for Contenders 6. Contenders 9 pts. 24,978
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 24,944
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 24,879
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 18,084
  10. Avatar for METU-BIN 10. METU-BIN 1 pt. 17,507

  1. Avatar for mirp
    1. mirp Lv 1
    100 pts. 28,934
  2. Avatar for toshiue 2. toshiue Lv 1 78 pts. 28,901
  3. Avatar for silent gene 3. silent gene Lv 1 60 pts. 28,832
  4. Avatar for Phyx 4. Phyx Lv 1 45 pts. 28,824
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 33 pts. 28,822
  6. Avatar for equilibria 6. equilibria Lv 1 24 pts. 28,813
  7. Avatar for kyoota 7. kyoota Lv 1 17 pts. 28,811
  8. Avatar for Anfinsen_slept_here 8. Anfinsen_slept_here Lv 1 12 pts. 28,804
  9. Avatar for Maerlyn138 9. Maerlyn138 Lv 1 8 pts. 28,802
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 6 pts. 28,568

Comments


beta_helix Staff Lv 1

Sequence:
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLLLTKEDFRYRS
PHSGDELYELLQHILGGGDLGKKLLEAARAGQDDEVRILMANGADVNATDNDGYTPLHLA
ASNGHLEIVEVLLKNGADVNASDLTGITPLHAAAATGHLEIVEVLLKHGADVNAYDNDGH
TPLHLAAKYGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN

Predicted Secondary Structure and more:
https://zhanglab.dcmb.med.umich.edu/I-TASSER/output/S624635/
(We are using the ZhangServer's Model1)

beta_helix Staff Lv 1

We could extend this, if needed, but the reason we did so last time was because we gave you 5 different starting models (and we wanted you to try out each of them).

There is only 1 model this time, so the only "difficultly" is the length: 235 residues might get a bit slow.

Please let us know what you all think after playing it for a day…

frood66 Lv 1

I can only assume that U R suggesting the starting (Zhang) layout is near correct.

that being the case….I will spend little (if any) time on this puzzle.

waste of time imao.

and this is from a long term player who particularly likes ED.

sorry

this place costs enough in machine power…..and kills machines quickly.

I'll not waste my time.

All the best ! :)

beta_helix Staff Lv 1

You can work on any puzzle you like, frood66!

Last time we gave you 5 models and no density.
This time we only have you 1 model because we provide you with density.

I hope this clears it up.

frood66 Lv 1

I have not played it…so who's the loser there?

give it 14 days…yr excuse is not of much value.

I love ED - it is my fave puzzle….I will always spend loads of time on it when the timescale and definition is of value.

Alas - not this time.

I'll look when it is reposted - cause it will be if it's of any value.

So yes BH - u cleared that up - not at all

beta_helix Staff Lv 1

You stated in your first post:
"how about 2 weeks? just a thought."
which sounded like a suggestion, not a request, nor an ultimatum.

Please be clear if you are asking for something, rather than just casually providing "just a thought".

It's a bit late to have an argument about this 2 days before the puzzle closes.
You posted your first comment the day the puzzle was released, and I replied the same day.
Next time I would suggest being upfront from the start, rather than waiting until 4 days later to bring this up again (when it's too late).

just a thought.

frood66 Lv 1

I thinkI was up front….right at the start…so what ARE u talking about?

I will add…..some years ago it was agreed by FC that all ED puzzles would state the definition….the Angstrom definition.

What happened to that promise?

please don't try to belittle me when others watch…u dig a pit.

can we get this sort of puzzle on a decent grounding please?

yes - u think I am being difficult - no - I am not…….just pointing stuff out.

Live with what U have promised…..appear sensible and proactive….players here will appreciate that.

Don't shoot the messenger…….I'm more or less the only one left that is prepared to call a spade a spade.

But I DO thank U for yr responses…..it makes a change.

frood

beta_helix Staff Lv 1

You make a lot of claims, frood66… and seem very passionate about those statements.

You have declared yourself the messenger (although I have never heard any other players bring any of these claims up)
so I will ask YOUR same question to you:

"what ARE u talking about?"

I have been part of FC since 2008 and do not recall any "promises" made about ED puzzles.

So please, rather than belittling FC, please show me where FC promised your claims.
This is your chance to make me look like a fool in the pit that I dug, so enjoy it!

frood66 Lv 1

U need to remember my friend…fc clearly said they would state angstrom definition for ED's.

Not my prob if U cannot remember

with best best wishes