Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 10,094
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 9,878
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,587
  4. Avatar for Texas Tech Red Folders 14. Texas Tech Red Folders 1 pt. 8,822
  5. Avatar for Window Group 15. Window Group 1 pt. 6,417
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 4,858
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,737
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 10,713
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 93 pts. 10,706
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 90 pts. 10,666
  5. Avatar for johnmitch 5. johnmitch Lv 1 86 pts. 10,645
  6. Avatar for fiendish_ghoul 6. fiendish_ghoul Lv 1 83 pts. 10,635
  7. Avatar for g_b 7. g_b Lv 1 80 pts. 10,623
  8. Avatar for christioanchauvin 8. christioanchauvin Lv 1 77 pts. 10,621
  9. Avatar for guineapig 9. guineapig Lv 1 74 pts. 10,594
  10. Avatar for robgee 10. robgee Lv 1 71 pts. 10,591

Comments