Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 10,094
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 9,878
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,587
  4. Avatar for Texas Tech Red Folders 14. Texas Tech Red Folders 1 pt. 8,822
  5. Avatar for Window Group 15. Window Group 1 pt. 6,417
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 4,858
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,735
  2. Avatar for toshiue 2. toshiue Lv 1 76 pts. 10,734
  3. Avatar for Maerlyn138 3. Maerlyn138 Lv 1 56 pts. 10,733
  4. Avatar for silent gene 4. silent gene Lv 1 41 pts. 10,733
  5. Avatar for mirp 5. mirp Lv 1 29 pts. 10,732
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 20 pts. 10,723
  7. Avatar for Deleted player 7. Deleted player 14 pts. 10,717
  8. Avatar for kyoota 8. kyoota Lv 1 9 pts. 10,714
  9. Avatar for LociOiling 9. LociOiling Lv 1 6 pts. 10,713
  10. Avatar for Galaxie 10. Galaxie Lv 1 4 pts. 10,610

Comments