Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Go Science 100 pts. 10,737
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,717
  3. Avatar for Contenders 3. Contenders 49 pts. 10,706
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,621
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,610
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,573
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,564
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 10,449
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 10,432
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,307

  1. Avatar for mwm64 101. mwm64 Lv 1 1 pt. 9,349
  2. Avatar for kevin everington 102. kevin everington Lv 1 1 pt. 9,265
  3. Avatar for ManVsYard 103. ManVsYard Lv 1 1 pt. 9,250
  4. Avatar for Terazawa 104. Terazawa Lv 1 1 pt. 9,242
  5. Avatar for parsnip 105. parsnip Lv 1 1 pt. 9,226
  6. Avatar for FishKAA 106. FishKAA Lv 1 1 pt. 9,149
  7. Avatar for zannipietro 107. zannipietro Lv 1 1 pt. 9,138
  8. Avatar for Onkelzfan3 108. Onkelzfan3 Lv 1 1 pt. 9,103
  9. Avatar for ivalnic 109. ivalnic Lv 1 1 pt. 9,092
  10. Avatar for kbill974 110. kbill974 Lv 1 1 pt. 9,090

Comments