Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Go Science 100 pts. 10,737
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,717
  3. Avatar for Contenders 3. Contenders 49 pts. 10,706
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,621
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,610
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,573
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,564
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 10,449
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 10,432
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,307

  1. Avatar for Hellcat6 81. Hellcat6 Lv 1 1 pt. 9,731
  2. Avatar for AeonFluff 82. AeonFluff Lv 1 1 pt. 9,696
  3. Avatar for tracybutt 83. tracybutt Lv 1 1 pt. 9,676
  4. Avatar for Dr.Sillem 84. Dr.Sillem Lv 1 1 pt. 9,665
  5. Avatar for Larini 85. Larini Lv 1 1 pt. 9,661
  6. Avatar for pascal ochem 86. pascal ochem Lv 1 1 pt. 9,645
  7. Avatar for Sleepyboi 87. Sleepyboi Lv 1 1 pt. 9,636
  8. Avatar for Evica 88. Evica Lv 1 1 pt. 9,634
  9. Avatar for ATP.synthase 89. ATP.synthase Lv 1 1 pt. 9,616
  10. Avatar for dahast.de 90. dahast.de Lv 1 1 pt. 9,587

Comments