Placeholder image of a protein
Icon representing a puzzle

2013: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
July 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 9,488
  2. Avatar for SARE/BRBT 2021 12. SARE/BRBT 2021 1 pt. 9,356
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 9,334
  4. Avatar for Team China 14. Team China 1 pt. 9,020
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,883
  6. Avatar for Spain Team 16. Spain Team 1 pt. 8,439
  7. Avatar for Window Group 17. Window Group 1 pt. 6,212

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,029
  2. Avatar for fiendish_ghoul 2. fiendish_ghoul Lv 1 97 pts. 10,890
  3. Avatar for grogar7 3. grogar7 Lv 1 93 pts. 10,888
  4. Avatar for Phyx 4. Phyx Lv 1 90 pts. 10,863
  5. Avatar for frood66 5. frood66 Lv 1 87 pts. 10,814
  6. Avatar for akaaka 6. akaaka Lv 1 84 pts. 10,800
  7. Avatar for toshiue 7. toshiue Lv 1 80 pts. 10,789
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 77 pts. 10,768
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 75 pts. 10,758
  10. Avatar for mirp 10. mirp Lv 1 72 pts. 10,728

Comments


Vincera Lv 1

Greetings, All.
Need some guidance on P2013: How do I know which Bridge Wiggle format to select since the Description denotes a Revisit of P69 but references P55;
AND
P1961 revisits P57 but is based on P55;
AND
P1532 is based on P69;
AND
P1077 is based on P69.

  • all with varying BWs.

LociOiling Lv 1

We've had a few of these scorpion toxins, with different configurations.

The unofficial cheat sheet for this is: https://foldit.fandom.com/wiki/Revisiting_puzzle/69:_Scorpion_Toxin

The bridges for this puzzle in Bridge Wiggle format are:

17,43 28,48 32,50 44,70

Your mileage may vary; some have had success with different bridge configurations on some of these puzzles. Also, for me, Bridge Wiggle has been less successful at wiggling recently. The banding feature can still be helpful. In some cases, I've been able to band, then form bridges by dragging the cysteines closer.

Vincera Lv 1

Thanx ever so much, Loci. I commenced with this same Hottentotta format but may not end with it. I did retain your Fandom notes from the Beta-Neurotoxin puzzle that you helped me with in February past. Much appreciation!