Placeholder image of a protein
Icon representing a puzzle

2013: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
July 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Beta Folders 100 pts. 11,029
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,921
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,897
  4. Avatar for Go Science 4. Go Science 36 pts. 10,866
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,683
  6. Avatar for Contenders 6. Contenders 16 pts. 10,632
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 10,367
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 10,252
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 9,520
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 9,493

  1. Avatar for rezaefar 71. rezaefar Lv 1 3 pts. 9,434
  2. Avatar for rakvium 72. rakvium Lv 1 3 pts. 9,400
  3. Avatar for kevin everington 73. kevin everington Lv 1 3 pts. 9,394
  4. Avatar for hada 74. hada Lv 1 3 pts. 9,381
  5. Avatar for MirsadaH 75. MirsadaH Lv 1 3 pts. 9,375
  6. Avatar for carlitosboy15 76. carlitosboy15 Lv 1 2 pts. 9,362
  7. Avatar for AS-BRBT21 77. AS-BRBT21 Lv 1 2 pts. 9,356
  8. Avatar for carsonfb 78. carsonfb Lv 1 2 pts. 9,336
  9. Avatar for vybi 79. vybi Lv 1 2 pts. 9,334
  10. Avatar for Evica 80. Evica Lv 1 2 pts. 9,333

Comments


Vincera Lv 1

Greetings, All.
Need some guidance on P2013: How do I know which Bridge Wiggle format to select since the Description denotes a Revisit of P69 but references P55;
AND
P1961 revisits P57 but is based on P55;
AND
P1532 is based on P69;
AND
P1077 is based on P69.

  • all with varying BWs.

LociOiling Lv 1

We've had a few of these scorpion toxins, with different configurations.

The unofficial cheat sheet for this is: https://foldit.fandom.com/wiki/Revisiting_puzzle/69:_Scorpion_Toxin

The bridges for this puzzle in Bridge Wiggle format are:

17,43 28,48 32,50 44,70

Your mileage may vary; some have had success with different bridge configurations on some of these puzzles. Also, for me, Bridge Wiggle has been less successful at wiggling recently. The banding feature can still be helpful. In some cases, I've been able to band, then form bridges by dragging the cysteines closer.

Vincera Lv 1

Thanx ever so much, Loci. I commenced with this same Hottentotta format but may not end with it. I did retain your Fandom notes from the Beta-Neurotoxin puzzle that you helped me with in February past. Much appreciation!