Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,021
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,922
  3. Avatar for SARE/BRBT 2021 13. SARE/BRBT 2021 1 pt. 9,592
  4. Avatar for test_group1 14. test_group1 1 pt. 3,796
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 3,796
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,957
  2. Avatar for grogar7 2. grogar7 Lv 1 97 pts. 10,950
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 93 pts. 10,944
  4. Avatar for mirp 4. mirp Lv 1 89 pts. 10,907
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 86 pts. 10,873
  6. Avatar for sallallami 6. sallallami Lv 1 82 pts. 10,852
  7. Avatar for MicElephant 7. MicElephant Lv 1 79 pts. 10,834
  8. Avatar for Aubade01 8. Aubade01 Lv 1 76 pts. 10,815
  9. Avatar for ZeroLeak7 9. ZeroLeak7 Lv 1 73 pts. 10,775
  10. Avatar for phi16 10. phi16 Lv 1 70 pts. 10,756

Comments