Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,021
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,922
  3. Avatar for SARE/BRBT 2021 13. SARE/BRBT 2021 1 pt. 9,592
  4. Avatar for test_group1 14. test_group1 1 pt. 3,796
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 3,796
  1. Avatar for Deleted player
    1. Deleted player
    100 pts. 10,956
  2. Avatar for LociOiling 2. LociOiling Lv 1 77 pts. 10,955
  3. Avatar for Galaxie 3. Galaxie Lv 1 58 pts. 10,947
  4. Avatar for toshiue 4. toshiue Lv 1 43 pts. 10,945
  5. Avatar for phi16 5. phi16 Lv 1 31 pts. 10,936
  6. Avatar for mirp 6. mirp Lv 1 22 pts. 10,930
  7. Avatar for kyoota 7. kyoota Lv 1 15 pts. 10,928
  8. Avatar for robgee 8. robgee Lv 1 11 pts. 10,912
  9. Avatar for alcor29 9. alcor29 Lv 1 7 pts. 10,882
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 5 pts. 10,848

Comments