Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,957
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,950
  3. Avatar for Go Science 3. Go Science 47 pts. 10,945
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,724
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,715
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,601
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 10,520
  8. Avatar for Contenders 8. Contenders 4 pts. 10,419
  9. Avatar for Australia 9. Australia 2 pts. 10,325
  10. Avatar for Team China 10. Team China 1 pt. 10,176
  1. Avatar for silent gene 11. silent gene Lv 1 3 pts. 10,846
  2. Avatar for Maerlyn138 12. Maerlyn138 Lv 1 2 pts. 10,838
  3. Avatar for MicElephant 13. MicElephant Lv 1 1 pt. 10,830
  4. Avatar for fpc 14. fpc Lv 1 1 pt. 10,715
  5. Avatar for jausmh 15. jausmh Lv 1 1 pt. 10,678
  6. Avatar for Lotus23 16. Lotus23 Lv 1 1 pt. 10,672
  7. Avatar for ManVsYard 17. ManVsYard Lv 1 1 pt. 10,597
  8. Avatar for equilibria 18. equilibria Lv 1 1 pt. 10,439
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 1 pt. 10,353
  10. Avatar for AlkiP0Ps 20. AlkiP0Ps Lv 1 1 pt. 10,325

Comments