Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,957
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,950
  3. Avatar for Go Science 3. Go Science 47 pts. 10,945
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,724
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,715
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,601
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 10,520
  8. Avatar for Contenders 8. Contenders 4 pts. 10,419
  9. Avatar for Australia 9. Australia 2 pts. 10,325
  10. Avatar for Team China 10. Team China 1 pt. 10,176

  1. Avatar for g_b 21. g_b Lv 1 43 pts. 10,689
  2. Avatar for neonrainbowtime 22. neonrainbowtime Lv 1 41 pts. 10,684
  3. Avatar for Galaxie 23. Galaxie Lv 1 39 pts. 10,653
  4. Avatar for NPrincipi 24. NPrincipi Lv 1 38 pts. 10,636
  5. Avatar for Phyx 25. Phyx Lv 1 36 pts. 10,634
  6. Avatar for Blipperman 26. Blipperman Lv 1 34 pts. 10,601
  7. Avatar for silent gene 27. silent gene Lv 1 33 pts. 10,584
  8. Avatar for OWM3 28. OWM3 Lv 1 31 pts. 10,581
  9. Avatar for jobo0502 29. jobo0502 Lv 1 30 pts. 10,547
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 28 pts. 10,527

Comments