Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 9,359
  2. Avatar for Australia 12. Australia 1 pt. 9,326
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,120
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team China 15. Team China 1 pt. 8,214
  6. Avatar for Deleted group 16. Deleted group pts. 4,879
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 4,879
  8. Avatar for Window Group 18. Window Group 1 pt. 4,879

  1. Avatar for eprata 131. eprata Lv 1 1 pt. 6,977
  2. Avatar for brucederby 132. brucederby Lv 1 1 pt. 5,158
  3. Avatar for ElAjoloteNegro 133. ElAjoloteNegro Lv 1 1 pt. 5,105
  4. Avatar for Cgriff42 134. Cgriff42 Lv 1 1 pt. 4,936
  5. Avatar for Sarah_D-U21 135. Sarah_D-U21 Lv 1 1 pt. 4,879
  6. Avatar for protein_crown13 136. protein_crown13 Lv 1 1 pt. 4,879
  7. Avatar for Vincera 137. Vincera Lv 1 1 pt. 4,879
  8. Avatar for Artoria2e5 138. Artoria2e5 Lv 1 1 pt. 4,879
  9. Avatar for devjosh 139. devjosh Lv 1 1 pt. 4,879
  10. Avatar for KoriLea01 140. KoriLea01 Lv 1 1 pt. 4,879

Comments