Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 9,359
  2. Avatar for Australia 12. Australia 1 pt. 9,326
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,120
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team China 15. Team China 1 pt. 8,214
  6. Avatar for Deleted group 16. Deleted group pts. 4,879
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 4,879
  8. Avatar for Window Group 18. Window Group 1 pt. 4,879
  1. Avatar for silent gene 31. silent gene Lv 1 32 pts. 10,181
  2. Avatar for borattt 32. borattt Lv 1 31 pts. 10,180
  3. Avatar for stomjoh 33. stomjoh Lv 1 29 pts. 10,131
  4. Avatar for katling 34. katling Lv 1 28 pts. 10,127
  5. Avatar for zackallen 35. zackallen Lv 1 27 pts. 10,126
  6. Avatar for Alistair69 36. Alistair69 Lv 1 26 pts. 10,088
  7. Avatar for ShadowTactics 37. ShadowTactics Lv 1 25 pts. 10,079
  8. Avatar for OWM3 38. OWM3 Lv 1 23 pts. 10,047
  9. Avatar for drjr 39. drjr Lv 1 22 pts. 10,008
  10. Avatar for xythus 40. xythus Lv 1 21 pts. 9,975

Comments