Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 9,359
  2. Avatar for Australia 12. Australia 1 pt. 9,326
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,120
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team China 15. Team China 1 pt. 8,214
  6. Avatar for Deleted group 16. Deleted group pts. 4,879
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 4,879
  8. Avatar for Window Group 18. Window Group 1 pt. 4,879
  1. Avatar for Simek 51. Simek Lv 1 13 pts. 9,796
  2. Avatar for Anfinsen_slept_here 52. Anfinsen_slept_here Lv 1 12 pts. 9,785
  3. Avatar for Deleted player 53. Deleted player pts. 9,784
  4. Avatar for ProfVince 54. ProfVince Lv 1 11 pts. 9,768
  5. Avatar for Crossed Sticks 55. Crossed Sticks Lv 1 10 pts. 9,712
  6. Avatar for Oransche 56. Oransche Lv 1 10 pts. 9,680
  7. Avatar for carsonfb 57. carsonfb Lv 1 9 pts. 9,677
  8. Avatar for Hellcat6 58. Hellcat6 Lv 1 9 pts. 9,676
  9. Avatar for BarrySampson 59. BarrySampson Lv 1 8 pts. 9,676
  10. Avatar for WBarme1234 60. WBarme1234 Lv 1 8 pts. 9,664

Comments