Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 9,359
  2. Avatar for Australia 12. Australia 1 pt. 9,326
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,120
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team China 15. Team China 1 pt. 8,214
  6. Avatar for Deleted group 16. Deleted group pts. 4,879
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 4,879
  8. Avatar for Window Group 18. Window Group 1 pt. 4,879
  1. Avatar for Larini 61. Larini Lv 1 7 pts. 9,659
  2. Avatar for jsfoldingaccount 62. jsfoldingaccount Lv 1 7 pts. 9,614
  3. Avatar for equilibria 63. equilibria Lv 1 7 pts. 9,599
  4. Avatar for heather-1 64. heather-1 Lv 1 6 pts. 9,544
  5. Avatar for jawz101 65. jawz101 Lv 1 6 pts. 9,522
  6. Avatar for Merf 66. Merf Lv 1 6 pts. 9,493
  7. Avatar for Evica 67. Evica Lv 1 5 pts. 9,488
  8. Avatar for hada 68. hada Lv 1 5 pts. 9,487
  9. Avatar for Trajan464 69. Trajan464 Lv 1 5 pts. 9,480
  10. Avatar for roman madala 70. roman madala Lv 1 4 pts. 9,477

Comments