Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 9,359
  2. Avatar for Australia 12. Australia 1 pt. 9,326
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,120
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team China 15. Team China 1 pt. 8,214
  6. Avatar for Deleted group 16. Deleted group pts. 4,879
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 4,879
  8. Avatar for Window Group 18. Window Group 1 pt. 4,879
  1. Avatar for fearjuan 71. fearjuan Lv 1 4 pts. 9,468
  2. Avatar for pmthomson90 72. pmthomson90 Lv 1 4 pts. 9,461
  3. Avatar for kyoota 73. kyoota Lv 1 4 pts. 9,448
  4. Avatar for rezaefar 74. rezaefar Lv 1 4 pts. 9,436
  5. Avatar for zippyc137 75. zippyc137 Lv 1 3 pts. 9,414
  6. Avatar for argyrw 76. argyrw Lv 1 3 pts. 9,409
  7. Avatar for tracybutt 77. tracybutt Lv 1 3 pts. 9,386
  8. Avatar for rinze 78. rinze Lv 1 3 pts. 9,361
  9. Avatar for dahast.de 79. dahast.de Lv 1 3 pts. 9,359
  10. Avatar for Wiz kid 80. Wiz kid Lv 1 2 pts. 9,326

Comments