Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 9,359
  2. Avatar for Australia 12. Australia 1 pt. 9,326
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,120
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team China 15. Team China 1 pt. 8,214
  6. Avatar for Deleted group 16. Deleted group pts. 4,879
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 4,879
  8. Avatar for Window Group 18. Window Group 1 pt. 4,879
  1. Avatar for cjddig 81. cjddig Lv 1 2 pts. 9,306
  2. Avatar for jausmh 82. jausmh Lv 1 2 pts. 9,291
  3. Avatar for HuubR 83. HuubR Lv 1 2 pts. 9,268
  4. Avatar for DScott 84. DScott Lv 1 2 pts. 9,267
  5. Avatar for fishercat 85. fishercat Lv 1 2 pts. 9,260
  6. Avatar for ManVsYard 86. ManVsYard Lv 1 2 pts. 9,255
  7. Avatar for AlkiP0Ps 87. AlkiP0Ps Lv 1 2 pts. 9,239
  8. Avatar for Dr.Sillem 88. Dr.Sillem Lv 1 2 pts. 9,214
  9. Avatar for fpc 89. fpc Lv 1 1 pt. 9,213
  10. Avatar for CharaLilith 90. CharaLilith Lv 1 1 pt. 9,194

Comments