Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since almost 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Go Science 100 pts. 10,752
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,722
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,696
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,502
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,356
  6. Avatar for Contenders 6. Contenders 18 pts. 10,321
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,215
  8. Avatar for BOINC@Poland 8. BOINC@Poland 8 pts. 10,079
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,796
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,461

  1. Avatar for mirp
    1. mirp Lv 1
    100 pts. 10,752
  2. Avatar for grogar7 2. grogar7 Lv 1 97 pts. 10,715
  3. Avatar for LociOiling 3. LociOiling Lv 1 94 pts. 10,696
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 91 pts. 10,578
  5. Avatar for guineapig 5. guineapig Lv 1 87 pts. 10,568
  6. Avatar for Maerlyn138 6. Maerlyn138 Lv 1 84 pts. 10,541
  7. Avatar for johnmitch 7. johnmitch Lv 1 81 pts. 10,509
  8. Avatar for Aubade01 8. Aubade01 Lv 1 79 pts. 10,484
  9. Avatar for Galaxie 9. Galaxie Lv 1 76 pts. 10,479
  10. Avatar for MicElephant 10. MicElephant Lv 1 73 pts. 10,465

Comments