Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,970
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 8,507
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,266
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,758
  5. Avatar for test 2 15. test 2 1 pt. 7,393
  6. Avatar for Window Group 16. Window Group 1 pt. 7,076

  1. Avatar for sallallami
    1. sallallami Lv 1
    100 pts. 9,782
  2. Avatar for Deleted player 2. Deleted player pts. 9,765
  3. Avatar for mirp 3. mirp Lv 1 94 pts. 9,736
  4. Avatar for frood66 4. frood66 Lv 1 91 pts. 9,735
  5. Avatar for grogar7 5. grogar7 Lv 1 88 pts. 9,722
  6. Avatar for LociOiling 6. LociOiling Lv 1 85 pts. 9,717
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 82 pts. 9,698
  8. Avatar for MicElephant 8. MicElephant Lv 1 79 pts. 9,685
  9. Avatar for Maerlyn138 9. Maerlyn138 Lv 1 76 pts. 9,663
  10. Avatar for Aubade01 10. Aubade01 Lv 1 74 pts. 9,640

Comments