Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since almost 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Go Science 100 pts. 9,770
  2. Avatar for Marvin's bunch 2. Marvin's bunch 71 pts. 9,736
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,727
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,717
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,605
  6. Avatar for Russian team 6. Russian team 14 pts. 9,479
  7. Avatar for Contenders 7. Contenders 8 pts. 9,391
  8. Avatar for Australia 8. Australia 5 pts. 9,186
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 9,068
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,021

  1. Avatar for LociOiling 11. LociOiling Lv 1 1 pt. 9,716
  2. Avatar for robgee 12. robgee Lv 1 1 pt. 9,710
  3. Avatar for alcor29 13. alcor29 Lv 1 1 pt. 9,708
  4. Avatar for MicElephant 14. MicElephant Lv 1 1 pt. 9,684

Comments