Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Go Science 100 pts. 9,770
  2. Avatar for Marvin's bunch 2. Marvin's bunch 71 pts. 9,736
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,727
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,717
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,605
  6. Avatar for Russian team 6. Russian team 14 pts. 9,479
  7. Avatar for Contenders 7. Contenders 8 pts. 9,391
  8. Avatar for Australia 8. Australia 5 pts. 9,186
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 9,068
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,021

  1. Avatar for XUEGG 141. XUEGG Lv 1 1 pt. 5,910
  2. Avatar for IgnisElit 142. IgnisElit Lv 1 1 pt. 5,897
  3. Avatar for jeff101 143. jeff101 Lv 1 1 pt. 5,878
  4. Avatar for evgent 144. evgent Lv 1 1 pt. 5,878
  5. Avatar for Amphimixus 145. Amphimixus Lv 1 1 pt. 5,878
  6. Avatar for misterben64 146. misterben64 Lv 1 1 pt. 5,878
  7. Avatar for Manandhar_45548315 147. Manandhar_45548315 Lv 1 1 pt. 5,878
  8. Avatar for milkshake 148. milkshake Lv 1 1 pt. 5,878
  9. Avatar for sakshamphul 149. sakshamphul Lv 1 1 pt. 5,878

Comments