Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,308
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,887
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,800
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,678
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 8,211
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 0
  1. Avatar for nicobul 91. nicobul Lv 1 2 pts. 8,283
  2. Avatar for jausmh 92. jausmh Lv 1 1 pt. 8,281
  3. Avatar for MirsadaH 93. MirsadaH Lv 1 1 pt. 8,211
  4. Avatar for NotJim99 94. NotJim99 Lv 1 1 pt. 8,171
  5. Avatar for mwm64 95. mwm64 Lv 1 1 pt. 8,133
  6. Avatar for carxo 96. carxo Lv 1 1 pt. 8,108
  7. Avatar for slamdunkin 97. slamdunkin Lv 1 1 pt. 8,107
  8. Avatar for bumdayma 98. bumdayma Lv 1 1 pt. 8,032
  9. Avatar for scottwuzhear 99. scottwuzhear Lv 1 1 pt. 8,029
  10. Avatar for red.sparrow 100. red.sparrow Lv 1 1 pt. 8,010

Comments