Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,308
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,887
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,800
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,678
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 8,211
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 0
  1. Avatar for katling 101. katling Lv 1 1 pt. 8,000
  2. Avatar for BathBall 102. BathBall Lv 1 1 pt. 7,956
  3. Avatar for ashika 103. ashika Lv 1 1 pt. 7,928
  4. Avatar for Zvxr 104. Zvxr Lv 1 1 pt. 7,902
  5. Avatar for aparnau 105. aparnau Lv 1 1 pt. 7,899
  6. Avatar for Mimikyuwu 106. Mimikyuwu Lv 1 1 pt. 7,835
  7. Avatar for Deleted player 107. Deleted player 1 pt. 7,833
  8. Avatar for DisboardGames 108. DisboardGames Lv 1 1 pt. 7,820
  9. Avatar for AmaralMo 109. AmaralMo Lv 1 1 pt. 7,813
  10. Avatar for dexterone 110. dexterone Lv 1 1 pt. 7,755

Comments