Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,308
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,887
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,800
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,678
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 8,211
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 0

  1. Avatar for malmanza 121. malmanza Lv 1 1 pt. 7,542
  2. Avatar for lickington 122. lickington Lv 1 1 pt. 7,530
  3. Avatar for JOE.CADILLAC555 123. JOE.CADILLAC555 Lv 1 1 pt. 7,524
  4. Avatar for KingCris 124. KingCris Lv 1 1 pt. 7,523
  5. Avatar for dsharts 125. dsharts Lv 1 1 pt. 7,521
  6. Avatar for Tenshirax 126. Tenshirax Lv 1 1 pt. 7,516
  7. Avatar for te21m002 127. te21m002 Lv 1 1 pt. 7,472
  8. Avatar for blablasusu 128. blablasusu Lv 1 1 pt. 7,295
  9. Avatar for chelseamunoz 129. chelseamunoz Lv 1 1 pt. 7,267
  10. Avatar for aejung 130. aejung Lv 1 1 pt. 7,194

Comments