Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,308
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,887
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,800
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,678
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 8,211
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 0

  1. Avatar for ithmy 131. ithmy Lv 1 1 pt. 7,178
  2. Avatar for cedukugho 132. cedukugho Lv 1 1 pt. 6,892
  3. Avatar for luis123 133. luis123 Lv 1 1 pt. 6,676
  4. Avatar for Alexis Fetzer 134. Alexis Fetzer Lv 1 1 pt. 6,334
  5. Avatar for LilyWilliams 135. LilyWilliams Lv 1 1 pt. 3,326
  6. Avatar for larryiscool1 136. larryiscool1 Lv 1 1 pt. 2,448
  7. Avatar for Kangacine 137. Kangacine Lv 1 1 pt. 1,476
  8. Avatar for tiffany7robin 138. tiffany7robin Lv 1 1 pt. 1,466
  9. Avatar for B10N3rd 139. B10N3rd Lv 1 1 pt. 866
  10. Avatar for brdo21 140. brdo21 Lv 1 1 pt. 0

Comments