Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,308
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,887
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,800
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,678
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 8,211
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 0
  1. Avatar for KaylaBamberg 141. KaylaBamberg Lv 1 1 pt. 0
  2. Avatar for Bletchley Park 142. Bletchley Park Lv 1 1 pt. 0
  3. Avatar for meagan2901 143. meagan2901 Lv 1 1 pt. 0
  4. Avatar for davidandersoniii 144. davidandersoniii Lv 1 1 pt. 0
  5. Avatar for PhilipS 145. PhilipS Lv 1 1 pt. 0
  6. Avatar for harvardman 146. harvardman Lv 1 1 pt. 0
  7. Avatar for mr_richi 147. mr_richi Lv 1 1 pt. 0
  8. Avatar for Jacky233 148. Jacky233 Lv 1 1 pt. 0
  9. Avatar for Super Noob9090781 149. Super Noob9090781 Lv 1 1 pt. 0
  10. Avatar for Sciren 150. Sciren Lv 1 1 pt. 0

Comments