Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,308
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,887
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,800
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,678
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 8,211
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 0
  1. Avatar for neon_fuzz 11. neon_fuzz Lv 1 71 pts. 10,134
  2. Avatar for silent gene 12. silent gene Lv 1 69 pts. 10,130
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 66 pts. 10,127
  4. Avatar for NPrincipi 14. NPrincipi Lv 1 64 pts. 10,122
  5. Avatar for NinjaGreg 15. NinjaGreg Lv 1 62 pts. 10,117
  6. Avatar for g_b 16. g_b Lv 1 60 pts. 10,114
  7. Avatar for Galaxie 17. Galaxie Lv 1 57 pts. 10,098
  8. Avatar for BarrySampson 18. BarrySampson Lv 1 55 pts. 10,085
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 53 pts. 10,069
  10. Avatar for robgee 20. robgee Lv 1 51 pts. 10,012

Comments