Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,308
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,887
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,800
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,678
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 8,211
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 0

  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 49 pts. 10,012
  2. Avatar for Bruno Kestemont 22. Bruno Kestemont Lv 1 48 pts. 9,995
  3. Avatar for jobo0502 23. jobo0502 Lv 1 46 pts. 9,992
  4. Avatar for dpmattingly 24. dpmattingly Lv 1 44 pts. 9,992
  5. Avatar for blazegeek 25. blazegeek Lv 1 42 pts. 9,947
  6. Avatar for Deleted player 26. Deleted player pts. 9,921
  7. Avatar for toshiue 27. toshiue Lv 1 39 pts. 9,914
  8. Avatar for guineapig 28. guineapig Lv 1 38 pts. 9,894
  9. Avatar for BootsMcGraw 29. BootsMcGraw Lv 1 36 pts. 9,877
  10. Avatar for phi16 30. phi16 Lv 1 35 pts. 9,829

Comments