Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,308
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,887
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,800
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,678
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 8,211
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 0
  1. Avatar for Vinara 31. Vinara Lv 1 33 pts. 9,822
  2. Avatar for dcrwheeler 32. dcrwheeler Lv 1 32 pts. 9,821
  3. Avatar for MicElephant 33. MicElephant Lv 1 31 pts. 9,811
  4. Avatar for akaaka 34. akaaka Lv 1 29 pts. 9,795
  5. Avatar for johnmitch 35. johnmitch Lv 1 28 pts. 9,766
  6. Avatar for Maerlyn138 36. Maerlyn138 Lv 1 27 pts. 9,722
  7. Avatar for bamh 37. bamh Lv 1 26 pts. 9,718
  8. Avatar for Lotus23 38. Lotus23 Lv 1 25 pts. 9,704
  9. Avatar for Vincera 39. Vincera Lv 1 24 pts. 9,698
  10. Avatar for maithra 40. maithra Lv 1 23 pts. 9,670

Comments