Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,308
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,887
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,800
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,678
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 8,211
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 0
  1. Avatar for infjamc 51. infjamc Lv 1 14 pts. 9,393
  2. Avatar for PeterDav 52. PeterDav Lv 1 13 pts. 9,347
  3. Avatar for heather-1 53. heather-1 Lv 1 12 pts. 9,328
  4. Avatar for Hellcat6 54. Hellcat6 Lv 1 12 pts. 9,327
  5. Avatar for Deleted player 55. Deleted player pts. 9,315
  6. Avatar for ShadowTactics 56. ShadowTactics Lv 1 11 pts. 9,308
  7. Avatar for antibot215 57. antibot215 Lv 1 10 pts. 9,280
  8. Avatar for Wiz kid 58. Wiz kid Lv 1 10 pts. 9,258
  9. Avatar for tracybutt 59. tracybutt Lv 1 9 pts. 9,245
  10. Avatar for Visok 60. Visok Lv 1 9 pts. 9,181

Comments