Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,308
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,887
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,800
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,678
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 8,211
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 0
  1. Avatar for Mohoernchen 81. Mohoernchen Lv 1 3 pts. 8,719
  2. Avatar for dahast.de 82. dahast.de Lv 1 3 pts. 8,678
  3. Avatar for hada 83. hada Lv 1 2 pts. 8,621
  4. Avatar for drjr 84. drjr Lv 1 2 pts. 8,588
  5. Avatar for Todd6485577 85. Todd6485577 Lv 1 2 pts. 8,577
  6. Avatar for fishercat 86. fishercat Lv 1 2 pts. 8,573
  7. Avatar for Rose621 87. Rose621 Lv 1 2 pts. 8,531
  8. Avatar for pascal ochem 88. pascal ochem Lv 1 2 pts. 8,528
  9. Avatar for frostschutz 89. frostschutz Lv 1 2 pts. 8,434
  10. Avatar for abiogenesis 90. abiogenesis Lv 1 2 pts. 8,431

Comments