Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,443
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,424
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,416
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,307
  5. Avatar for Go Science 5. Go Science 22 pts. 10,302
  6. Avatar for HMT heritage 6. HMT heritage 14 pts. 10,238
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,012
  8. Avatar for Contenders 8. Contenders 5 pts. 9,877
  9. Avatar for Deleted group 9. Deleted group pts. 9,698
  10. Avatar for Australia 10. Australia 2 pts. 9,423

  1. Avatar for kyoota 11. kyoota Lv 1 4 pts. 10,291
  2. Avatar for silent gene 12. silent gene Lv 1 2 pts. 10,285
  3. Avatar for NotJim99 13. NotJim99 Lv 1 2 pts. 10,230
  4. Avatar for Oransche 14. Oransche Lv 1 1 pt. 10,224
  5. Avatar for gmn 15. gmn Lv 1 1 pt. 10,222
  6. Avatar for phi16 16. phi16 Lv 1 1 pt. 10,222
  7. Avatar for alcor29 17. alcor29 Lv 1 1 pt. 10,181
  8. Avatar for neon_fuzz 18. neon_fuzz Lv 1 1 pt. 9,985
  9. Avatar for Phyx 19. Phyx Lv 1 1 pt. 9,973
  10. Avatar for Maerlyn138 20. Maerlyn138 Lv 1 1 pt. 9,968

Comments