Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,443
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,424
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,416
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,307
  5. Avatar for Go Science 5. Go Science 22 pts. 10,302
  6. Avatar for HMT heritage 6. HMT heritage 14 pts. 10,238
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,012
  8. Avatar for Contenders 8. Contenders 5 pts. 9,877
  9. Avatar for Deleted group 9. Deleted group pts. 9,698
  10. Avatar for Australia 10. Australia 2 pts. 9,423

  1. Avatar for Oransche 71. Oransche Lv 1 5 pts. 8,999
  2. Avatar for rezaefar 72. rezaefar Lv 1 5 pts. 8,987
  3. Avatar for kevin everington 73. kevin everington Lv 1 4 pts. 8,982
  4. Avatar for fpc 74. fpc Lv 1 4 pts. 8,972
  5. Avatar for avogadro.toast 75. avogadro.toast Lv 1 4 pts. 8,903
  6. Avatar for AlphaFold2 76. AlphaFold2 Lv 1 4 pts. 8,887
  7. Avatar for Trajan464 77. Trajan464 Lv 1 3 pts. 8,841
  8. Avatar for Borets 78. Borets Lv 1 3 pts. 8,800
  9. Avatar for marsfan 79. marsfan Lv 1 3 pts. 8,736
  10. Avatar for rinze 80. rinze Lv 1 3 pts. 8,722

Comments