Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,443
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,424
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,416
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,307
  5. Avatar for Go Science 5. Go Science 22 pts. 10,302
  6. Avatar for HMT heritage 6. HMT heritage 14 pts. 10,238
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,012
  8. Avatar for Contenders 8. Contenders 5 pts. 9,877
  9. Avatar for Deleted group 9. Deleted group pts. 9,698
  10. Avatar for Australia 10. Australia 2 pts. 9,423

  1. Avatar for Tonzi 111. Tonzi Lv 1 1 pt. 7,723
  2. Avatar for ManVsYard 112. ManVsYard Lv 1 1 pt. 7,712
  3. Avatar for Mikhael451 113. Mikhael451 Lv 1 1 pt. 7,690
  4. Avatar for emilymonahan 114. emilymonahan Lv 1 1 pt. 7,687
  5. Avatar for banerjeeblue13 115. banerjeeblue13 Lv 1 1 pt. 7,645
  6. Avatar for Jacob Lijoy 116. Jacob Lijoy Lv 1 1 pt. 7,639
  7. Avatar for Swapper242 117. Swapper242 Lv 1 1 pt. 7,617
  8. Avatar for ivalnic 118. ivalnic Lv 1 1 pt. 7,598
  9. Avatar for furi0us 119. furi0us Lv 1 1 pt. 7,596
  10. Avatar for bipanachundali 120. bipanachundali Lv 1 1 pt. 7,586

Comments