Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,443
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,424
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,416
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,307
  5. Avatar for Go Science 5. Go Science 22 pts. 10,302
  6. Avatar for HMT heritage 6. HMT heritage 14 pts. 10,238
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,012
  8. Avatar for Contenders 8. Contenders 5 pts. 9,877
  9. Avatar for Deleted group 9. Deleted group pts. 9,698
  10. Avatar for Australia 10. Australia 2 pts. 9,423

  1. Avatar for Beany 61. Beany Lv 1 8 pts. 9,154
  2. Avatar for Evica 62. Evica Lv 1 8 pts. 9,151
  3. Avatar for Dr.Sillem 63. Dr.Sillem Lv 1 7 pts. 9,136
  4. Avatar for Merf 64. Merf Lv 1 7 pts. 9,110
  5. Avatar for Alistair69 65. Alistair69 Lv 1 7 pts. 9,086
  6. Avatar for kyoota 66. kyoota Lv 1 6 pts. 9,074
  7. Avatar for pfirth 67. pfirth Lv 1 6 pts. 9,058
  8. Avatar for Flagg65a 68. Flagg65a Lv 1 6 pts. 9,044
  9. Avatar for Deleted player 69. Deleted player 5 pts. 9,030
  10. Avatar for DScott 70. DScott Lv 1 5 pts. 9,012

Comments