Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 8,616
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,320
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 8,027
  4. Avatar for MGC 2020 14. MGC 2020 1 pt. 7,319
  5. Avatar for BT21s 15. BT21s 1 pt. 6,639
  6. Avatar for Window Group 16. Window Group 1 pt. 5,829
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 0
  9. Avatar for Deleted group 19. Deleted group pts. 0

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,428
  2. Avatar for Deleted player 2. Deleted player 78 pts. 10,379
  3. Avatar for Beany 3. Beany Lv 1 60 pts. 10,358
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 45 pts. 10,334
  5. Avatar for Galaxie 5. Galaxie Lv 1 33 pts. 10,316
  6. Avatar for silent gene 6. silent gene Lv 1 24 pts. 10,316
  7. Avatar for puxatudo 7. puxatudo Lv 1 17 pts. 10,314
  8. Avatar for toshiue 8. toshiue Lv 1 12 pts. 10,265
  9. Avatar for phi16 9. phi16 Lv 1 8 pts. 10,241
  10. Avatar for gmn 10. gmn Lv 1 6 pts. 10,235

Comments