Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 8,616
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,320
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 8,027
  4. Avatar for MGC 2020 14. MGC 2020 1 pt. 7,319
  5. Avatar for BT21s 15. BT21s 1 pt. 6,639
  6. Avatar for Window Group 16. Window Group 1 pt. 5,829
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 0
  9. Avatar for Deleted group 19. Deleted group pts. 0

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,427
  2. Avatar for Enzyme 2. Enzyme Lv 1 97 pts. 10,376
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 93 pts. 10,336
  4. Avatar for silent gene 4. silent gene Lv 1 90 pts. 10,268
  5. Avatar for gmn 5. gmn Lv 1 87 pts. 10,266
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 84 pts. 10,247
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 80 pts. 10,237
  8. Avatar for Deleted player 8. Deleted player 77 pts. 10,216
  9. Avatar for Lotus23 9. Lotus23 Lv 1 75 pts. 10,208
  10. Avatar for grogar7 10. grogar7 Lv 1 72 pts. 10,196

Comments