Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 8,616
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,320
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 8,027
  4. Avatar for MGC 2020 14. MGC 2020 1 pt. 7,319
  5. Avatar for BT21s 15. BT21s 1 pt. 6,639
  6. Avatar for Window Group 16. Window Group 1 pt. 5,829
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 0
  9. Avatar for Deleted group 19. Deleted group pts. 0
  1. Avatar for phi16 41. phi16 Lv 1 18 pts. 9,822
  2. Avatar for Vincera 42. Vincera Lv 1 17 pts. 9,792
  3. Avatar for alcor29 43. alcor29 Lv 1 17 pts. 9,725
  4. Avatar for kentish_alex 44. kentish_alex Lv 1 16 pts. 9,721
  5. Avatar for georg137 45. georg137 Lv 1 15 pts. 9,660
  6. Avatar for equilibria 46. equilibria Lv 1 14 pts. 9,654
  7. Avatar for infjamc 47. infjamc Lv 1 13 pts. 9,634
  8. Avatar for ProfVince 48. ProfVince Lv 1 13 pts. 9,602
  9. Avatar for BarrySampson 49. BarrySampson Lv 1 12 pts. 9,592
  10. Avatar for jawz101 50. jawz101 Lv 1 11 pts. 9,495

Comments