Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 8,616
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,320
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 8,027
  4. Avatar for MGC 2020 14. MGC 2020 1 pt. 7,319
  5. Avatar for BT21s 15. BT21s 1 pt. 6,639
  6. Avatar for Window Group 16. Window Group 1 pt. 5,829
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 0
  9. Avatar for Deleted group 19. Deleted group pts. 0
  1. Avatar for Oransche 61. Oransche Lv 1 6 pts. 8,976
  2. Avatar for Jajaboman 62. Jajaboman Lv 1 6 pts. 8,932
  3. Avatar for Wiz kid 63. Wiz kid Lv 1 5 pts. 8,929
  4. Avatar for antibot215 64. antibot215 Lv 1 5 pts. 8,891
  5. Avatar for tracybutt 65. tracybutt Lv 1 5 pts. 8,874
  6. Avatar for a5hm0r 66. a5hm0r Lv 1 5 pts. 8,843
  7. Avatar for zackallen 67. zackallen Lv 1 4 pts. 8,792
  8. Avatar for Merf 68. Merf Lv 1 4 pts. 8,754
  9. Avatar for PeterDav 69. PeterDav Lv 1 4 pts. 8,751
  10. Avatar for toshiue 70. toshiue Lv 1 4 pts. 8,737

Comments