Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 8,616
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,320
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 8,027
  4. Avatar for MGC 2020 14. MGC 2020 1 pt. 7,319
  5. Avatar for BT21s 15. BT21s 1 pt. 6,639
  6. Avatar for Window Group 16. Window Group 1 pt. 5,829
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 0
  9. Avatar for Deleted group 19. Deleted group pts. 0
  1. Avatar for rinze 71. rinze Lv 1 3 pts. 8,735
  2. Avatar for Trajan464 72. Trajan464 Lv 1 3 pts. 8,705
  3. Avatar for DScott 73. DScott Lv 1 3 pts. 8,679
  4. Avatar for mwm64 74. mwm64 Lv 1 3 pts. 8,666
  5. Avatar for Hellcat6 75. Hellcat6 Lv 1 3 pts. 8,663
  6. Avatar for VogSok 76. VogSok Lv 1 2 pts. 8,628
  7. Avatar for dahast.de 77. dahast.de Lv 1 2 pts. 8,616
  8. Avatar for Beany 78. Beany Lv 1 2 pts. 8,599
  9. Avatar for Arne Heessels 79. Arne Heessels Lv 1 2 pts. 8,561
  10. Avatar for Visok 80. Visok Lv 1 2 pts. 8,438

Comments