Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,428
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 10,376
  3. Avatar for Go Science 3. Go Science 56 pts. 10,336
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,316
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,218
  6. Avatar for Contenders 6. Contenders 20 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 10,105
  8. Avatar for Australia 8. Australia 9 pts. 9,260
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,069
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 8,932
  1. Avatar for robgee 11. robgee Lv 1 4 pts. 10,231
  2. Avatar for jausmh 12. jausmh Lv 1 2 pts. 10,218
  3. Avatar for alcor29 13. alcor29 Lv 1 2 pts. 10,165
  4. Avatar for Maerlyn138 14. Maerlyn138 Lv 1 1 pt. 10,151
  5. Avatar for argyrw 15. argyrw Lv 1 1 pt. 10,149
  6. Avatar for fpc 16. fpc Lv 1 1 pt. 10,148
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 1 pt. 10,140
  8. Avatar for Oransche 18. Oransche Lv 1 1 pt. 10,119
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 1 pt. 10,035
  10. Avatar for georg137 20. georg137 Lv 1 1 pt. 9,878

Comments