Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,428
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 10,376
  3. Avatar for Go Science 3. Go Science 56 pts. 10,336
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,316
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,218
  6. Avatar for Contenders 6. Contenders 20 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 10,105
  8. Avatar for Australia 8. Australia 9 pts. 9,260
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,069
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 8,932

  1. Avatar for drumpeter18yrs9yrs 121. drumpeter18yrs9yrs Lv 1 1 pt. 6,479
  2. Avatar for jflat06 122. jflat06 Lv 1 1 pt. 5,829
  3. Avatar for stefanboca 123. stefanboca Lv 1 1 pt. 5,460
  4. Avatar for Ben37hak 125. Ben37hak Lv 1 1 pt. 481
  5. Avatar for silvio daniel 126. silvio daniel Lv 1 1 pt. 343
  6. Avatar for s680426 127. s680426 Lv 1 1 pt. 0
  7. Avatar for haemolacria 128. haemolacria Lv 1 1 pt. 0
  8. Avatar for joshmiller 129. joshmiller Lv 1 1 pt. 0

Comments