Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,428
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 10,376
  3. Avatar for Go Science 3. Go Science 56 pts. 10,336
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,316
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,218
  6. Avatar for Contenders 6. Contenders 20 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 10,105
  8. Avatar for Australia 8. Australia 9 pts. 9,260
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,069
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 8,932

  1. Avatar for frood66 11. frood66 Lv 1 69 pts. 10,163
  2. Avatar for Skippysk8s 12. Skippysk8s Lv 1 66 pts. 10,162
  3. Avatar for jausmh 13. jausmh Lv 1 64 pts. 10,159
  4. Avatar for Galaxie 14. Galaxie Lv 1 61 pts. 10,144
  5. Avatar for johnmitch 15. johnmitch Lv 1 59 pts. 10,142
  6. Avatar for g_b 16. g_b Lv 1 57 pts. 10,127
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 54 pts. 10,105
  8. Avatar for robgee 18. robgee Lv 1 52 pts. 10,094
  9. Avatar for akaaka 19. akaaka Lv 1 50 pts. 10,074
  10. Avatar for MicElephant 20. MicElephant Lv 1 48 pts. 10,063

Comments